Structure of PDB 3o0e Chain A Binding Site BS01

Receptor Information

>3o0e Chain A (length=340) Species: 562 (Escherichia coli)

AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQ
INSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGR
NYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDG
LNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQ
EAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGF
ANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGAT
YYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF

Ligand information

>3o0e Chain L (length=14) Species: 562 (Escherichia coli)

SGGDGRGHNTGAHS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3o0e Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF.
• Resolution: 3.01 Å
• Binding residue (original residue number in PDB): E48 R82 K89 Y106 D107 D113 M114 L115 E117 R140 S142 F153 R270 Y302
• Binding residue (residue number reindexed from 1): E48 R82 K89 Y106 D107 D113 M114 L115 E117 R140 S142 F153 R270 Y302

Gene Ontology

Molecular Function

• GO:0001530 lipopolysaccharide binding
• GO:0005216 monoatomic ion channel activity
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0015288 porin activity
• GO:0042802 identical protein binding
• GO:0042912 colicin transmembrane transporter activity
• GO:0097718 disordered domain specific binding

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0015031 protein transport
• GO:0034220 monoatomic ion transmembrane transport
• GO:0043213 bacteriocin transport
• GO:0070207 protein homotrimerization

Cellular Component

• GO:0009279 cell outer membrane
• GO:0016020 membrane
• GO:0034702 monoatomic ion channel complex
• GO:0046930 pore complex

External links

• PDB: RCSB:3o0e, PDBe:3o0e, PDBj:3o0e
• PDBsum: 3o0e
• PubMed: 21098297
• UniProt: P02931|OMPF_ECOLI Outer membrane porin F (Gene Name=ompF)