Structure of PDB 3nzi Chain A Binding Site BS01

Receptor Information
>3nzi Chain A (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIV
SEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQ
GKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGL
RNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDK
IKKFLTESHDR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3nzi Substrate-induced remodeling of the active site regulates human HTRA1 activity.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		H220 L309 N324 Y325 G326 S328 T344 L345 K346
Binding residue
(residue number reindexed from 1)		H61 L150 N165 Y166 G167 S169 T185 L186 K187
Enzymatic activity
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3nzi, PDBe:3nzi, PDBj:3nzi
PDBsum3nzi
PubMed21297635
UniProtQ92743|HTRA1_HUMAN Serine protease HTRA1 (Gene Name=HTRA1)

[Back to BioLiP]