Structure of PDB 3ny3 Chain A Binding Site BS01

Receptor Information
>3ny3 Chain A (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGG
FCDCGDTEAWKEGPYCQKHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ny3 Structural basis of substrate recognition and specificity in the N-end rule pathway.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		T120 G146 G147 F148 D150 D153
Binding residue
(residue number reindexed from 1)		T23 G49 G50 F51 D53 D56
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3ny3, PDBe:3ny3, PDBj:3ny3
PDBsum3ny3
PubMed20835242
UniProtQ8IWV8|UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 (Gene Name=UBR2)

[Back to BioLiP]