Structure of PDB 3nvi Chain A Binding Site BS01

Receptor Information
>3nvi Chain A (length=247) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSGARDKMVIQAIEALDDVDKVINLLVARLREWYSLHFPELDELLPKHPQ
YVAFVKTVGHRDNINEEVLRELGLSEEKIKKILEAKEKTMGAWMDQTDIE
VVRQLAEEIDRLYQLRKKLEDYIDRAMDDVAPNLKALVGAKLAARLISLA
GGLRELAMMPSSTIQVLGAEKALFRHLRTGAKPPKHGVIYQYPAINRSPW
WQRGKIARALAGKLAIAARVDYFSGEYIAEELKKELEARIREIKEKY
Ligand information
>3nvi Chain E (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cucugaccgaaaggcgugaugagc
..<...<<....>>......>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3nvi Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
Resolution2.709 Å
Binding residue
(original residue number in PDB)		S288 T289 Q291 A295 L299 F300 R301 H302 L303 K308 P309 P310 K311 H312 Y316 G330 K331 R334 K339 R365 E368 K372
Binding residue
(residue number reindexed from 1)		S162 T163 Q165 A169 L173 F174 R175 H176 L177 K182 P183 P184 K185 H186 Y190 G204 K205 R208 K213 R239 E242 K246
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030515 snoRNA binding
Cellular Component
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3nvi, PDBe:3nvi, PDBj:3nvi
PDBsum3nvi
PubMed20864039
UniProtQ8U4M1

[Back to BioLiP]