Structure of PDB 3nti Chain A Binding Site BS01

Receptor Information
>3nti Chain A (length=163) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELHNCVVVQFDGPMSFYVQMESDVPALEQMTDKLLDAEQDLPAFSDLKEG
ALCVAQFPEDEVFYRAQIRKVLDDGKCEVHFIDFGNNAVTQQFRQLPEEL
AKPARYSRHCELDASTISAALLQSFIDTRFSETFQVEILATKGTGTHVVR
LFYQSKNISEKLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3nti Structural basis for methylarginine-dependent recognition of Aubergine by Tudor
Resolution2.8 Å
Binding residue
(original residue number in PDB)
V2354 Q2365 L2373 E2374 T2377 F2403 Y2410 F2427 F2430 N2432 F2479
Binding residue
(residue number reindexed from 1)
V8 Q19 L27 E28 T31 F57 Y64 F81 F84 N86 F130
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3nti, PDBe:3nti, PDBj:3nti
PDBsum3nti
PubMed20713507
UniProtP25823|TUD_DROME Maternal protein tudor (Gene Name=tud)

[Back to BioLiP]