Structure of PDB 3nnc Chain A Binding Site BS01

Receptor Information
>3nnc Chain A (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCC
FVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFI
GMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQ
TAIKAMHQAQTMEGCSSPMVVKFAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3nnc Structural Insights into RNA Recognition by the Alternate-Splicing Regulator CUG-Binding Protein 1.
Resolution2.2005 Å
Binding residue
(original residue number in PDB)		K109 F111 G113 M114 E136 R138 L140 R148 G149 C150 F152 S178 V182 K184 A186 D187
Binding residue
(residue number reindexed from 1)		K97 F99 G101 M102 E124 R126 L128 R136 G137 C138 F140 S166 V170 K172 A174 D175
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Cellular Component
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3nnc, PDBe:3nnc, PDBj:3nnc
PDBsum3nnc
PubMed20947024
UniProtQ92879|CELF1_HUMAN CUGBP Elav-like family member 1 (Gene Name=CELF1)

[Back to BioLiP]