Structure of PDB 3njj Chain A Binding Site BS01

Receptor Information
>3njj Chain A (length=111) Species: 70863 (Shewanella oneidensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTL
KGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSN
TANTLLVLSAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3njj Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
Resolution1.56 Å
Binding residue
(original residue number in PDB)		Y26 G36 D37 I38 T39 V40 T41 I72 D89 D91 T93 P94 G95 T96 T97 K98 F99
Binding residue
(residue number reindexed from 1)		Y21 G31 D32 I33 T34 V35 T36 I67 D84 D86 T88 P89 G90 T91 T92 K93 F94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0046872 metal ion binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3njj, PDBe:3njj, PDBj:3njj
PDBsum3njj
PubMed22493430
UniProtQ8EGA7

[Back to BioLiP]