Structure of PDB 3njg Chain A Binding Site BS01

Receptor Information
>3njg Chain A (length=112) Species: 70863 (Shewanella oneidensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQT
LKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTAFQFVLS
NTANTLLVLSPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3njg Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
Resolution1.92 Å
Binding residue
(original residue number in PDB)		Y26 G36 D37 I38 T39 V40 T41 I72 D89 D91 T93 P94 G95 T96 T97 A98 F99 D116
Binding residue
(residue number reindexed from 1)		Y22 G32 D33 I34 T35 V36 T37 I68 D85 D87 T89 P90 G91 T92 T93 A94 F95 D112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0046872 metal ion binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3njg, PDBe:3njg, PDBj:3njg
PDBsum3njg
PubMed22493430
UniProtQ8EGA7

[Back to BioLiP]