Structure of PDB 3nin Chain A Binding Site BS01

Receptor Information
>3nin Chain A (length=80) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VHKHTGRNCGRKFKIGEPLYRCHECGCDDTCVLCIHCFNPKDHVNHHVCT
DICTEFTSGICDCGDEEAWNSPLHCKAEEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3nin Structural basis for the recognition of N-end rule substrates by the UBR box of ubiquitin ligases
Resolution2.1 Å
Binding residue
(original residue number in PDB)
L133 T144 C145 F170 T171 S172 G173 I174 D176 A182
Binding residue
(residue number reindexed from 1)
L19 T30 C31 F56 T57 S58 G59 I60 D62 A68
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3nin, PDBe:3nin, PDBj:3nin
PDBsum3nin
PubMed20835240
UniProtP19812|UBR1_YEAST E3 ubiquitin-protein ligase UBR1 (Gene Name=UBR1)

[Back to BioLiP]