Structure of PDB 3nic Chain A Binding Site BS01

Receptor Information

>3nic Chain A (length=210) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HNKKFDRSEHVYRNDSFLELIKDAVRFFSGTPVHSLPPPERFQGAGVFAL
YYTGHYSLYDEYSRINRKAYNLPIYVGKAVPAGWRQSRISDHETRAGSEL
SNRIREHGRNIAKTSNLDLCDFSCRFVIFEATGSDMISTVEAALIKIYKP
LWNTVVDGFGNHTPGAGRFAQAKSDWDVIHPGREWAEKCTGVHSEPYFIE
ERIKQYFSKS

Ligand information

>3nic Chain M (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgggaggcccgcgggccgccgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3nic Folding, DNA Recognition, and Function of GIY-YIG Endonucleases: Crystal Structures of R.Eco29kI.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	R86 T164 P165 G166 A167 R169
Binding residue (residue number reindexed from 1)	R85 T163 P164 G165 A166 R168

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0042802	identical protein binding

View graph for
Molecular Function

External links

PDB	RCSB:3nic, PDBe:3nic, PDBj:3nic
PDBsum	3nic
PubMed	20800503
UniProt	Q46944

[Back to BioLiP]