Structure of PDB 3nfk Chain A Binding Site BS01

Receptor Information
>3nfk Chain A (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNE
GDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3nfk Peptides Targeting the PDZ Domain of PTPN4 Are Efficient Inducers of Glioblastoma Cell Death.
Resolution1.43 Å
Binding residue
(original residue number in PDB)
R527 F528 G529 F530 N531 V532 K533 Q538 S545 H579 D580 V583 L584 K587
Binding residue
(residue number reindexed from 1)
R15 F16 G17 F18 N19 V20 K21 Q26 S33 H67 D68 V71 L72 K75
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:3nfk, PDBe:3nfk, PDBj:3nfk
PDBsum3nfk
PubMed22000519
UniProtP29074|PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 (Gene Name=PTPN4)

[Back to BioLiP]