Structure of PDB 3ndb Chain A Binding Site BS01

Receptor Information

>3ndb Chain A (length=87) Species: 2190 (Methanocaldococcus jannaschii)

MIIWPSYIDKKKSRREGRKVPEELAIEKPSLKDIEKALKKLGLEPKIYRD
KRYPRQHWEICGCVEVDYKGNKLQLLKEICKIIKGKN

Ligand information

>3ndb Chain M (length=136)

gucucgucccguggggcucggcggugggggagcaucuccuguaggggaga
uguaacccccuuuaccugccgaaccccgccaggcccggaagggagcaacg
guaggcaggacgucggcgcucacgggggugcgggac

<<.<<<.<<<<<<<<<<.<<<<<..<<<<<.<<<<<<<<<....>>>>>>
>>>..>>>>>....<<<<<<.....<<<...<.<<<....>>>..>..>>
>..>>>>>>.>>>>>>>.>>>>>>>>....>>>.>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3ndb Structural basis of signal-sequence recognition by the signal recognition particle.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): M1 I2 W4 Y7 S13 R14 R15 R18 K19 P21 E22 K51 R52 Y53 P54 R55 H57 D67 Y68 K69 K72
• Binding residue (residue number reindexed from 1): M1 I2 W4 Y7 S13 R14 R15 R18 K19 P21 E22 K51 R52 Y53 P54 R55 H57 D67 Y68 K69 K72

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0008312 7S RNA binding

Biological Process

• GO:0006612 protein targeting to membrane
• GO:0006614 SRP-dependent cotranslational protein targeting to membrane

Cellular Component

• GO:0005737 cytoplasm
• GO:0048500 signal recognition particle

External links

• PDB: RCSB:3ndb, PDBe:3ndb, PDBj:3ndb
• PDBsum: 3ndb
• PubMed: 21336278
• UniProt: Q58440|SRP19_METJA Signal recognition particle 19 kDa protein (Gene Name=srp19)