Structure of PDB 3n97 Chain A Binding Site BS01

Receptor Information
>3n97 Chain A (length=53) Species: 271 (Thermus aquaticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKL
RHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3n97 The RNA Polymerase alpha Subunit Recognizes the DNA Shape of the Upstream Promoter Element.
Resolution3.252 Å
Binding residue
(original residue number in PDB)		R379 V407 T408 E410 R411 Q414
Binding residue
(residue number reindexed from 1)		R6 V34 T35 E37 R38 Q41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3n97, PDBe:3n97, PDBj:3n97
PDBsum3n97
PubMed33205945
UniProtQ9EZJ8|SIGA_THEAQ RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]