Structure of PDB 3n7o Chain A Binding Site BS01

Receptor Information
>3n7o Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRS
ITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKAS
LTLAVGTLPFPSFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQA
CSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDA
KPPAVFTRISHYQPWINQILQAN
Ligand information
Ligand IDN7O
InChIInChI=1S/C19H15ClF2NO3PS/c1-27(25,26)18(14-10-28-17-5-3-12(20)9-13(14)17)19(24)23-7-6-11-2-4-15(21)16(22)8-11/h2-10,18H,1H3,(H,23,24)(H,25,26)/b7-6+/t18-/m0/s1
InChIKeySEXLHAASDZPHOM-DKFQHHCZSA-N
SMILES
SoftwareSMILES
CACTVS 3.370C[P](O)(=O)[CH](C(=O)NC=Cc1ccc(F)c(F)c1)c2csc3ccc(Cl)cc23
OpenEye OEToolkits 1.7.0CP(=O)(C(c1csc2c1cc(cc2)Cl)C(=O)NC=Cc3ccc(c(c3)F)F)O
CACTVS 3.370C[P](O)(=O)[C@H](C(=O)N/C=C/c1ccc(F)c(F)c1)c2csc3ccc(Cl)cc23
ACDLabs 12.01Fc1ccc(cc1F)\C=C\NC(=O)C(c2c3cc(Cl)ccc3sc2)P(=O)(O)C
OpenEye OEToolkits 1.7.0C[P@@](=O)([C@@H](c1csc2c1cc(cc2)Cl)C(=O)N/C=C/c3ccc(c(c3)F)F)O
FormulaC19 H15 Cl F2 N O3 P S
Name(S)-[(1S)-1-(5-chloro-1-benzothiophen-3-yl)-2-{[(E)-2-(3,4-difluorophenyl)ethenyl]amino}-2-oxoethyl]methylphosphinic acid
ChEMBL
DrugBank
ZINCZINC000013982784
PDB chain3n7o Chain A Residue 1 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3n7o Potency variation of small-molecule chymase inhibitors across species.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		H57 Y94 N95 T96 L99 D102 A190 F191 K192 S195 S214 Y215 G216
Binding residue
(residue number reindexed from 1)		H45 Y81 N82 T83 L86 D89 A174 F175 K176 S179 S194 Y195 G196
Annotation score1
Binding affinityMOAD: Ki=72nM
PDBbind-CN: -logKd/Ki=7.14,Ki=72nM
BindingDB: IC50=58nM
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 K192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H45 D89 K176 G177 D178 S179 G180
Enzyme Commision number 3.4.21.39: chymase.
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0042277 peptide binding
Biological Process
GO:0002003 angiotensin maturation
GO:0006508 proteolysis
GO:0006518 peptide metabolic process
GO:0016485 protein processing
GO:0022617 extracellular matrix disassembly
GO:0030163 protein catabolic process
GO:0030901 midbrain development
GO:0034769 basement membrane disassembly
GO:0045766 positive regulation of angiogenesis
GO:0050727 regulation of inflammatory response
GO:0071333 cellular response to glucose stimulus
GO:0140447 cytokine precursor processing
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030141 secretory granule
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0043231 intracellular membrane-bounded organelle
GO:0062023 collagen-containing extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3n7o, PDBe:3n7o, PDBj:3n7o
PDBsum3n7o
PubMed20599788
UniProtP23946|CMA1_HUMAN Chymase (Gene Name=CMA1)

[Back to BioLiP]