Structure of PDB 3n4m Chain A Binding Site BS01

Receptor Information

>3n4m Chain A (length=203) Species: 83333 (Escherichia coli K-12)

TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEG
KEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLI
QVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDA
MTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
GTR

Ligand information

>3n4m Chain D (length=20)

cttttttcctaaaatgtgat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3n4m The RNA Polymerase alpha Subunit Recognizes the DNA Shape of the Upstream Promoter Element.
• Resolution: 2.987 Å
• Binding residue (original residue number in PDB): T168 R169 Q170 R180 E181 R185
• Binding residue (residue number reindexed from 1): T162 R163 Q164 R174 E175 R179

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003680 minor groove of adenine-thymine-rich DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0008301 DNA binding, bending
• GO:0030552 cAMP binding
• GO:0042802 identical protein binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006351 DNA-templated transcription
• GO:0006355 regulation of DNA-templated transcription
• GO:0045013 carbon catabolite repression of transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:3n4m, PDBe:3n4m, PDBj:3n4m
• PDBsum: 3n4m
• PubMed: 33205945
• UniProt: P0ACJ8|CRP_ECOLI DNA-binding transcriptional dual regulator CRP (Gene Name=crp)