Structure of PDB 3n3x Chain A Binding Site BS01

Receptor Information

>3n3x Chain A (length=246) Species: 3672 (Momordica balsamina) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DVSFRLSGADPSSYGMFIKDLRNALPHTEKVYNIPLLLPSVSGAGRYLLM
HLFNYDGNTITVAVDVTNVYIMGYLALTTSYFFNEPAADLASQYVFRSAR
RKITLPYSGNYERLQIAAGKPREKIPIGLPALDTAISTLLHYDSTAAAGA
LLVLIQTTAEAARFKYIEQQIQERAYRDEVPSSATISLENSWSGLSKQIQ
LAQGNNGVFRTPTVLVDSKGNRVQITNVTSNVVTSNIQLLLNTKNI

Ligand information

>3n3x Chain B (length=6) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SDDDMG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3n3x Crystal Structure of the complex formed between type I ribosome inactivating protein and hexapeptide Ser-Asp-Asp-Asp-Met-Gly at 1.7 A resolution
Resolution	1.7 Å
Binding residue (original residue number in PDB)	Y166 Q169 Q170 E173 R174 E179 V180 S182 D217 S218 N231 N236
Binding residue (residue number reindexed from 1)	Y166 Q169 Q170 E173 R174 E179 V180 S182 D217 S218 N231 N236

Enzymatic activity

Catalytic site (original residue number in PDB)	I71 E160 R163
Catalytic site (residue number reindexed from 1)	I71 E160 R163
Enzyme Commision number	3.2.2.22: rRNA N-glycosylase.

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0016787	hydrolase activity
GO:0030598	rRNA N-glycosylase activity
GO:0090729	toxin activity

	Biological Process
GO:0017148	negative regulation of translation
GO:0035821	modulation of process of another organism

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3n3x, PDBe:3n3x, PDBj:3n3x
PDBsum	3n3x
PubMed
UniProt	D9J2T9

[Back to BioLiP]