Structure of PDB 3n1k Chain A Binding Site BS01

Receptor Information
>3n1k Chain A (length=161) Species: 4113 (Solanum tuberosum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRVFAPYSVFKGKAALSAEPRLPTFNRLDSGGVKLNRRGVIMLTFWPSVG
ERKYDWEKRQLFALSATEVGSLISMGTRDSSEFFHDPSMLSSNAGQVRKS
LSIKPNADGSGYFISLSVVNNNLKTNDRFTVPVTTAEFAVMRTAFSFALP
HIMGWDRFTNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3n1k Crystal Structures of DNA-Whirly Complexes and Their Role in Arabidopsis Organelle Genome Repair.
Resolution2.702 Å
Binding residue
(original residue number in PDB)		L82 F116 A117 F138 H139 D140 M143 L144 K153
Binding residue
(residue number reindexed from 1)		L28 F62 A63 F84 H85 D86 M89 L90 K99
Binding affinityPDBbind-CN: Kd=5.73nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006952 defense response

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3n1k, PDBe:3n1k, PDBj:3n1k
PDBsum3n1k
PubMed20551348
UniProtD9J034|WHY2_SOLTU Single-stranded DNA-binding protein WHY2, mitochondrial (Gene Name=WHY2)

[Back to BioLiP]