Structure of PDB 3n1i Chain A Binding Site BS01

Receptor Information

>3n1i Chain A (length=161) Species: 4113 (Solanum tuberosum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRVFAPYSVFKGKAALSAEPRLPTFNRLDSGGVKLNRRGVIMLTFWPSVG
ERKYDWEKRQLFALSATEVGSLISMGTRDSSEFFHDPSMLSSNAGQVRKS
LSIKPNADGSGYFISLSVVNNNLKTNDRFTVPVTTAEFAVMRTAFSFALP
HIMGWDRFTNR

Ligand information

>3n1i Chain B (length=9) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttttttttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3n1i Crystal Structures of DNA-Whirly Complexes and Their Role in Arabidopsis Organelle Genome Repair.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	L82 M96 L115 A117 H139 D140 M143 L144 K153
Binding residue (residue number reindexed from 1)	L28 M42 L61 A63 H85 D86 M89 L90 K99
Binding affinity	PDBbind-CN: Kd=3.35nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003697	single-stranded DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006952	defense response

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3n1i, PDBe:3n1i, PDBj:3n1i
PDBsum	3n1i
PubMed	20551348
UniProt	D9J034\|WHY2_SOLTU Single-stranded DNA-binding protein WHY2, mitochondrial (Gene Name=WHY2)

[Back to BioLiP]