Structure of PDB 3n00 Chain A Binding Site BS01

Receptor Information
>3n00 Chain A (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTVEDVISQVARAHREIFVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDL
SQHDQVTLLKAGTFEVLMVRFASLFNVKDELGAMGMGDLLSAMFDFSEKL
NSLALTEEELGLFTAVVLVSADRSGMENSASVEQLQETLLRALRALVLKN
RPLETSRFTKLLLKLPDLRTLNNMHSEKLLSFRV
Ligand information
>3n00 Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
THRLITLADHICQIITQDFAR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3n00 Structure of Rev-erbalpha bound to N-CoR reveals a unique mechanism of nuclear receptor-co-repressor interaction.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Q433 W436 E437 F443 T444 V447 Q465 L472 K473 F477 S603 K605 L606 L607 S608 F609 R610 V611
Binding residue
(residue number reindexed from 1)		Q20 W23 E24 F30 T31 V34 Q52 L59 K60 F64 S176 K178 L179 L180 S181 F182 R183 V184
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3n00, PDBe:3n00, PDBj:3n00
PDBsum3n00
PubMed20581824
UniProtP20393|NR1D1_HUMAN Nuclear receptor subfamily 1 group D member 1 (Gene Name=NR1D1)

[Back to BioLiP]