Structure of PDB 3mxy Chain A Binding Site BS01

Receptor Information
>3mxy Chain A (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKF
GNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDI
E
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mxy Functional Implications of the Conformational Switch in AICD Peptide upon Binding to Grb2-SH2 Domain.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
R67 R86 S96 H107 F108 K109 L120 W121
Binding residue
(residue number reindexed from 1)
R16 R35 S45 H56 F57 K58 L69 W70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3mxy, PDBe:3mxy, PDBj:3mxy
PDBsum3mxy
PubMed22001015
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]