Structure of PDB 3mxb Chain A Binding Site BS01

Receptor Information
>3mxb Chain A (length=153) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKKFLLYLAGFVDGDGSIIAQINPNQSSKFKHRLRLTFYVTQKTQR
RWFLDKLVDEIGVGYVRDSGSVSQYVLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mxb Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
D20 S22 I24 Q26 Y44 T46 Q47 K48 R51 Q75 N136 D137 S138 T140 K142
Binding residue
(residue number reindexed from 1)
D19 S21 I23 Q25 Y43 T45 Q46 K47 R50 Q74 N135 D136 S137 T139 K141
Binding affinityPDBbind-CN: Kd=28nM
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Nov 24 08:34:42 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3mxb', asym_id = 'A', bs = 'BS01', title = 'Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3mxb', asym_id='A', bs='BS01', title='Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '3mxb', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='3mxb', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>