Structure of PDB 3mul Chain A Binding Site BS01

Receptor Information
>3mul Chain A (length=127) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDA
VKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIY
NKPGDDIVLMAEALEKLFLQKINELPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mul Interaction of propionylated and butyrylated histone H3 lysine marks with Brd4 bromodomains
Resolution1.65 Å
Binding residue
(original residue number in PDB)
L92 N140 I146
Binding residue
(residue number reindexed from 1)
L53 N101 I107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3mul, PDBe:3mul, PDBj:3mul
PDBsum3mul
PubMed20715035
UniProtQ9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 (Gene Name=Brd4)

[Back to BioLiP]