Structure of PDB 3mqk Chain A Binding Site BS01

Receptor Information

>3mqk Chain A (length=328) Species: 2261 (Pyrococcus furiosus)

RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGP
TSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAG
KEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYY
IEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGP
FKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKD
SAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQ
EMLEKTKGIAVDVEKVFMPRDWYPKLWE

Ligand information

>3mqk Chain D (length=13)

guucgauccacag

.............

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3mqk Structural and functional evidence of high specificity of Cbf5 for ACA trinucleotide.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): S261 A262 A265 H268 G269 A270 L272 A273 P275 G276 K317 G318 K335 W337
• Binding residue (residue number reindexed from 1): S251 A252 A255 H258 G259 A260 L262 A263 P265 G266 K307 G308 K325 W327

Enzymatic activity

• Catalytic site (original residue number in PDB): D85 Y113 R184
• Catalytic site (residue number reindexed from 1): D75 Y103 R174
• Enzyme Commision number: 5.4.99.25: tRNA pseudouridine(55) synthase.

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0009982 pseudouridine synthase activity
• GO:0016853 isomerase activity
• GO:0160148 tRNA pseudouridine(55) synthase activity

Biological Process

• GO:0000495 box H/ACA sno(s)RNA 3'-end processing
• GO:0001522 pseudouridine synthesis
• GO:0006396 RNA processing
• GO:0008033 tRNA processing
• GO:0009451 RNA modification
• GO:0031118 rRNA pseudouridine synthesis
• GO:0031119 tRNA pseudouridine synthesis
• GO:0031120 snRNA pseudouridine synthesis
• GO:1990481 mRNA pseudouridine synthesis

External links

• PDB: RCSB:3mqk, PDBe:3mqk, PDBj:3mqk
• PDBsum: 3mqk
• PubMed: 21149572
• UniProt: Q7LWY0|TRUB_PYRFU Probable tRNA pseudouridine synthase B (Gene Name=truB)