Structure of PDB 3ml4 Chain A Binding Site BS01

Receptor Information

>3ml4 Chain A (length=205) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EAALVEGQVKLRKWKSRWLVLRKPSPVADCLLMLVYKDKCERSKGLRERS
SLTLEDICGLEPALPYEGLAHTLAIICLSQAVMLGFDSHEAMCAWDTRIR
YALGEVHRFHVTVAPGTKLESGPATLHLCNDILVLARDIPPTVMGQWKLS
DLRRYGAVPNGFIFEGGTRCGYWAGVFFLSSAEGEQMSFLFDCIVRGISP
TKGPF

Ligand information

>3ml4 Chain E (length=9) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LHPNPMYQR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3ml4 The Cytoplasmic Adaptor Protein Dok7 Activates the Receptor Tyrosine Kinase MuSK via Dimerization.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	S155 D156 L157 R158 R159 Y160 G161 T173 R174 D197 V200
Binding residue (residue number reindexed from 1)	S150 D151 L152 R153 R154 Y155 G156 T168 R169 D192 V195

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0019901	protein kinase binding

	Biological Process
GO:0061098	positive regulation of protein tyrosine kinase activity

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3ml4, PDBe:3ml4, PDBj:3ml4
PDBsum	3ml4
PubMed	20603078
UniProt	Q18PE0\|DOK7_MOUSE Protein Dok-7 (Gene Name=Dok7)

[Back to BioLiP]