Structure of PDB 3mkz Chain A Binding Site BS01

Receptor Information
>3mkz Chain A (length=112) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSV
VALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADE
VITLLTSVLKTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mkz Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
Resolution2.98 Å
Binding residue
(original residue number in PDB)		R163 I188 S189 I192 R195 S217 A218 R219 S220
Binding residue
(residue number reindexed from 1)		R7 I32 S33 I36 R39 S61 A62 R63 S64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3mkz, PDBe:3mkz, PDBj:3mkz
PDBsum3mkz
PubMed20236989
UniProtP62558|SOPB_ECOLI Protein SopB (Gene Name=sopB)

[Back to BioLiP]