Structure of PDB 3mk8 Chain A Binding Site BS01

Receptor Information
>3mk8 Chain A (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DELYRQSLEIISRYLREQATGASGATSRKALETLRRVGDGVQRNHETAFQ
GMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLK
TINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mk8 The MCL-1 BH3 helix is an exclusive MCL-1 inhibitor and apoptosis sensitizer.
Resolution2.321 Å
Binding residue
(original residue number in PDB)		H224 M231 H252 V253 S255 D256 G262 R263 T266 F318 F319
Binding residue
(residue number reindexed from 1)		H45 M52 H73 V74 S76 D77 G83 R84 T87 F139 F140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3mk8, PDBe:3mk8, PDBj:3mk8
PDBsum3mk8
PubMed20562877
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]