Structure of PDB 3mj0 Chain A Binding Site BS01

Receptor Information
>3mj0 Chain A (length=118) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQS
APRVYRVNGLSRAPASSETFEHDGKKVTIASYFHSRNYPLKFPQLHCLNV
GSSIKSILLPIELCSIEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mj0 Crystal Structure of drosophila Ago2 PAZ domain in complex with 3'-end 2'-O-methylated RNA
Resolution2.306 Å
Binding residue
(original residue number in PDB)		Y641 F647 R652 F669 Y681 K704 L707
Binding residue
(residue number reindexed from 1)		Y42 F48 R53 F70 Y82 K105 L108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3mj0, PDBe:3mj0, PDBj:3mj0
PDBsum3mj0
PubMed
UniProtQ9VUQ5|AGO2_DROME Protein argonaute-2 (Gene Name=AGO2)

[Back to BioLiP]