Structure of PDB 3mip Chain A Binding Site BS01

Receptor Information

>3mip Chain A (length=161) Species: 32630 (synthetic construct)

TLQPTEAAYIAGFLDGDGSIYARLEPRPDYKDIKYQVRLAISFIQRKDKF
PYLQDIYDQLGKRGILRKDRGDGIADYRIYGSTHLSIILPDLVPYLRIKK
KQANRILHIINLYPQAQKNPSKFLDLVKIVDDVQNLNKRADELKSTNYDR
LLEEFLKAGKI

Ligand information

>3mip Chain C (length=24)

gcaggcggtcgtgagaccgctccg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3mip Computational reprogramming of homing endonuclease specificity at multiple adjacent base pairs.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): R32 D34 Y35 K36 Q41 R43 I70 R72 R75 R83 Y85 G86 Y118 Q122 R144
• Binding residue (residue number reindexed from 1): R27 D29 Y30 K31 Q36 R38 I65 R67 R70 R78 Y80 G81 Y113 Q117 R139

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 13:27:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3mip', asym_id = 'A', bs = 'BS01', title = 'Computational reprogramming of homing endonuclease specificity at multiple adjacent base pairs.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3mip', asym_id='A', bs='BS01', title='Computational reprogramming of homing endonuclease specificity at multiple adjacent base pairs.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '3mip', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='3mip', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>