Structure of PDB 3mgb Chain A Binding Site BS01

Receptor Information
>3mgb Chain A (length=286) Species: 164851 (uncultured soil bacterium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSHHHHHHSSSMNGIRWIASYPKAGNTWVRCMLAAYITGKAPQVWNDIDA
ESLTLEAMLRFGDLPPAEPMEPVLVKTHLKADVPVLGLYGEATAKVLYLV
RNPRDMLLSSMRMASISRDDVEKSRDFARKFIANEGLGWNALGAGGGVGL
GSWPENVRSWTESSSDRFPNADVLTMRYEDLKGDPVARFSEIVEFLDLGG
PVDIEDIRRAVAASTLERMRELEKRSGGSPIMMKGGPGGARPQFVGEGRY
DQSLSFLGEDIESDYQELLHGDSGFALYAKQYGYAG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mgb Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
Resolution2.04 Å
Binding residue
(original residue number in PDB)		H-26 H-25 H-24 S-23 S-22 K213 M232 K233 G234 G235 G238 A239 R240 Q242
Binding residue
(residue number reindexed from 1)		H6 H7 H8 S9 S10 K224 M233 K234 G235 G236 G239 A240 R241 Q243
Enzymatic activity
Catalytic site (original residue number in PDB) K12 H67 S98
Catalytic site (residue number reindexed from 1) K23 H78 S109
Enzyme Commision number 2.8.2.-
Gene Ontology
Molecular Function
GO:0008146 sulfotransferase activity
GO:0016740 transferase activity
GO:0042277 peptide binding
Biological Process
GO:0051923 sulfation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3mgb, PDBe:3mgb, PDBj:3mgb
PDBsum3mgb
PubMed20361791
UniProtB7T1D7

[Back to BioLiP]