Structure of PDB 3mg9 Chain A Binding Site BS01

Receptor Information

>3mg9 Chain A (length=255) Species: 164851 (uncultured soil bacterium)

AAAASMNGIRWIASYPKAGNTWVRCMLAAYITGKAPQVWNDIDAESLTLE
AMLRFGDLPPAEPMEPVLVKTHLKADVPVLGLYGEATAKVLYLVRNPRDM
LLSSMRMASISRDDVEKSRDFARKFIANEGLGWNGGVGLGSWPENVRSWT
ESSSDRFPNADVLTMRYEDLKGDPVARFSEIVEFLDLGGPVDIEDIRRAV
AASTLERMRELEKRSEGRYDQSLSFLGEDIESDYQELLHGDSGFALYAKQ
YGYAG

Ligand information

>3mg9 Chain B (length=7) Species: 93944 (Nonomuraea gerenzanensis)

GFIGGFI

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3mg9 Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
• Resolution: 2.27 Å
• Binding residue (original residue number in PDB): K12 R90 L97 S98 R101 S106 R107 D108 Y167 E206 R207 E210 K213 R214 R248 Q251
• Binding residue (residue number reindexed from 1): K17 R95 L102 S103 R106 S111 R112 D113 Y167 E206 R207 E210 K213 R214 R218 Q221

Enzymatic activity

• Catalytic site (original residue number in PDB): K12 H67 S98
• Catalytic site (residue number reindexed from 1): K17 H72 S103
• Enzyme Commision number: 2.8.2.-

Gene Ontology

Molecular Function

• GO:0008146 sulfotransferase activity
• GO:0016740 transferase activity
• GO:0042277 peptide binding

Biological Process

• GO:0051923 sulfation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3mg9, PDBe:3mg9, PDBj:3mg9
• PDBsum: 3mg9
• PubMed: 20361791
• UniProt: B7T1D7