Structure of PDB 3me9 Chain A Binding Site BS01

Receptor Information
>3me9 Chain A (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVA
ARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPL
PQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVL
FEDTSYADGYSPPLNVAQRYVVAC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3me9 Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
Resolution1.37 Å
Binding residue
(original residue number in PDB)		R116 Q174 D194 D196 Y238 Q240 T241 T242 Y245 E265 D266
Binding residue
(residue number reindexed from 1)		R3 Q61 D81 D83 Y125 Q127 T128 T129 Y132 E152 D153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:3me9, PDBe:3me9, PDBj:3me9
PDBsum3me9
PubMed21685874
UniProtQ96ES7|SGF29_HUMAN SAGA-associated factor 29 (Gene Name=SGF29)

[Back to BioLiP]