Structure of PDB 3mdg Chain A Binding Site BS01

Receptor Information
>3mdg Chain A (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMR
RTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTE
ILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLV
QLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mdg Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing.
Resolution2.22 Å
Binding residue
(original residue number in PDB)		E55 S58 S59 R63 G100 T102 F103 F104 P155 P206 G207 Y208 G209
Binding residue
(residue number reindexed from 1)		E28 S31 S32 R36 G73 T75 F76 F77 P128 P179 G180 Y181 G182
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0035925 mRNA 3'-UTR AU-rich region binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0042826 histone deacetylase binding
Biological Process
GO:0006397 mRNA processing
GO:0010608 post-transcriptional regulation of gene expression
GO:0030154 cell differentiation
GO:0031124 mRNA 3'-end processing
GO:0051262 protein tetramerization
GO:0051290 protein heterotetramerization
GO:0110104 mRNA alternative polyadenylation
GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway
GO:2000738 positive regulation of stem cell differentiation
GO:2000975 positive regulation of pro-B cell differentiation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
GO:0005849 mRNA cleavage factor complex
GO:0016604 nuclear body
GO:0034451 centriolar satellite
GO:0042382 paraspeckles

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3mdg, PDBe:3mdg, PDBj:3mdg
PDBsum3mdg
PubMed20479262
UniProtO43809|CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 (Gene Name=NUDT21)

[Back to BioLiP]