Structure of PDB 3mbe Chain A Binding Site BS01

Receptor Information

>3mbe Chain A (length=184) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEF
GQLILFEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVL
LGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKL
SYLTFIPSDDDIYDCKVEHWGLEEPVLKHWSSAD

Ligand information

>3mbe Chain P (length=17) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GAMKRHGLDNYRGYSLG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3mbe The diabetogenic mouse MHC class II molecule I-Ag7 is endowed with a switch that modulates TCR affinity.
Resolution	2.886 Å
Binding residue (original residue number in PDB)	H24 W43 I52 L53 N62 A65 E66 H68 N69 I72
Binding residue (residue number reindexed from 1)	H26 W45 I54 L55 N64 A67 E68 H70 N71 I74

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3mbe, PDBe:3mbe, PDBj:3mbe
PDBsum	3mbe
PubMed	20407212
UniProt	P04228\|HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain (Gene Name=H2-Aa)

[Back to BioLiP]