Structure of PDB 3maz Chain A Binding Site BS01

Receptor Information
>3maz Chain A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEID
IPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3maz Loops govern SH2 domain specificity by controlling access to binding pockets.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R184 R203 S206 S212 I219 K225 H226 Y227 K228 L240 E241 F256 T260 R261
Binding residue
(residue number reindexed from 1)		R14 R33 S36 S42 I49 K55 H56 Y57 K58 L70 E71 F86 T90 R91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035591 signaling adaptor activity

View graph for
Molecular Function
External links
PDB RCSB:3maz, PDBe:3maz, PDBj:3maz
PDBsum3maz
PubMed20442417
UniProtQ9ULZ2|STAP1_HUMAN Signal-transducing adaptor protein 1 (Gene Name=STAP1)

[Back to BioLiP]