Structure of PDB 3m7u Chain A Binding Site BS01

Receptor Information
>3m7u Chain A (length=198) Species: 69 (Lysobacter enzymogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAV
VGTFAARVFPGNDAAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAV
CRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITS
AGQAQGVMSGGNVQSNGNNCGIPASQRSSLFQRLQPILSQYGLSLVTG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3m7u The 0.83 A resolution crystal structure of alpha-lytic protease reveals the detailed structure of the active site and identifies a source of conformational strain.
Resolution1.05 Å
Binding residue
(original residue number in PDB)		H36 N122 Y123 A124 G160 G161
Binding residue
(residue number reindexed from 1)		H36 N122 Y123 A124 G160 G161
Enzymatic activity
Catalytic site (original residue number in PDB) H36 D63 G141 S143 S159
Catalytic site (residue number reindexed from 1) H36 D63 G141 S143 S159
Enzyme Commision number 3.4.21.12: alpha-lytic endopeptidase.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3m7u, PDBe:3m7u, PDBj:3m7u
PDBsum3m7u
PubMed
UniProtP00778|PRLA_LYSEN Alpha-lytic protease (Gene Name=alpha-LP)

[Back to BioLiP]