Structure of PDB 3m7k Chain A Binding Site BS01

Receptor Information
>3m7k Chain A (length=142) Species: 43263 (Pseudomonas alcaligenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKAT
FLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGY
SPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3m7k Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.
Resolution1.92 Å
Binding residue
(original residue number in PDB)
R6 Y35 K39 P81 R82 R114
Binding residue
(residue number reindexed from 1)
R6 Y35 K39 P81 R82 R114
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:3m7k, PDBe:3m7k, PDBj:3m7k
PDBsum3m7k
PubMed20541511
UniProtD5MNX7

[Back to BioLiP]