Structure of PDB 3m59 Chain A Binding Site BS01

Receptor Information
>3m59 Chain A (length=245) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMI
EGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSCISTNALLPDPYESER
VYVAESLISSAGEGLFSKVAVGPNTVMSFANGVRITHQEVDSRDWALNGN
TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGP
IKCIRTLRAVEADEELTVAYGYDHSPGPEAPEWYQVELKAFQATQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3m59 SET7/9 catalytic mutants reveal the role of active site water molecules in lysine multiple methylation.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		H252 V255 D256 R258 W260 N263 T266 L267 S268 E271 Y305 K317 Y335 Y337 D338
Binding residue
(residue number reindexed from 1)		H137 V140 D141 R143 W145 N148 T151 L152 S153 E156 Y190 K202 Y220 Y222 D223
Enzymatic activity
Catalytic site (original residue number in PDB) A245 H293 H297 Y305 Y335
Catalytic site (residue number reindexed from 1) A130 H178 H182 Y190 Y220
Enzyme Commision number 2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0016279 protein-lysine N-methyltransferase activity
GO:0140945 histone H3K4 monomethyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3m59, PDBe:3m59, PDBj:3m59
PDBsum3m59
PubMed20675860
UniProtQ8WTS6|SETD7_HUMAN Histone-lysine N-methyltransferase SETD7 (Gene Name=SETD7)

[Back to BioLiP]