Structure of PDB 3lwv Chain A Binding Site BS01

Receptor Information
>3lwv Chain A (length=317) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGP
TSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAG
KEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRLRTRKVYYIEVLEIEGRD
VLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITL
HDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGA
DLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIA
VDVEKVFMPRDWYPKLW
Ligand information
>3lwv Chain D (length=58) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggccacggaaaccgcgcgcggugaucaaugagccgcguucgcucccgug
gcccacaa
<<<<<<<<<.......<<<<<<<.........>>>>>>>......>>>>>
>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lwv Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
Resolution2.499 Å
Binding residue
(original residue number in PDB)		G59 T61 H63 E64 K77 A78 H80 R101 Q104 S261 A262 A265 H268 G269 A270 A273 P275 G276 K317 G318 I319 V323 K325 V326 R330 L336 W337
Binding residue
(residue number reindexed from 1)		G49 T51 H53 E54 K67 A68 H70 R91 Q94 S241 A242 A245 H248 G249 A250 A253 P255 G256 K297 G298 I299 V303 K305 V306 R310 L316 W317
Enzymatic activity
Catalytic site (original residue number in PDB) D85 Y113 R184
Catalytic site (residue number reindexed from 1) D75 Y103 R164
Enzyme Commision number 5.4.99.25: tRNA pseudouridine(55) synthase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0009982 pseudouridine synthase activity
GO:0016853 isomerase activity
GO:0160148 tRNA pseudouridine(55) synthase activity
Biological Process
GO:0000495 box H/ACA sno(s)RNA 3'-end processing
GO:0001522 pseudouridine synthesis
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0009451 RNA modification
GO:0031118 rRNA pseudouridine synthesis
GO:0031119 tRNA pseudouridine synthesis
GO:0031120 snRNA pseudouridine synthesis
GO:1990481 mRNA pseudouridine synthesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3lwv, PDBe:3lwv, PDBj:3lwv
PDBsum3lwv
PubMed20575532
UniProtQ7LWY0|TRUB_PYRFU Probable tRNA pseudouridine synthase B (Gene Name=truB)

[Back to BioLiP]