Structure of PDB 3lwi Chain A Binding Site BS01

Receptor Information
>3lwi Chain A (length=58) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRH
KLPDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lwi Structural insights into the interaction of the crenarchaeal chromatin protein Cren7 with DNA
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K24 W26 L28 A29 P30 K31 L40 Y49 R51
Binding residue
(residue number reindexed from 1)		K22 W24 L26 A27 P28 K29 L38 Y47 R49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3lwi, PDBe:3lwi, PDBj:3lwi
PDBsum3lwi
PubMed20345658
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]