Structure of PDB 3lv3 Chain A Binding Site BS01

Receptor Information
>3lv3 Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYG
CDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lv3 Loss of recognition by cross-reactive T cells and its relation to a C-terminus-induced conformational reorientation of an HLA-B*2705-bound peptide.
Resolution1.94 Å
Binding residue
(original residue number in PDB)
Y7 H9 T24 E45 R62 E63 Q65 I66 C67 E76 D77 Y84 L95 Y99 D116 T143 W147 V152 Q155 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 H9 T24 E45 R62 E63 Q65 I66 C67 E76 D77 Y84 L95 Y99 D116 T143 W147 V152 Q155 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3lv3, PDBe:3lv3, PDBj:3lv3
PDBsum3lv3
PubMed21280120
UniProtP01889|HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain (Gene Name=HLA-B)

[Back to BioLiP]