Structure of PDB 3luo Chain A Binding Site BS01

Receptor Information
>3luo Chain A (length=145) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG
EAFQAHVPAEKAYGPHDPEGVQVVPLSAFPPGAQFYAQDMEGNPMPLTVV
AVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3luo Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
Resolution2.55 Å
Binding residue
(original residue number in PDB)		D23 L36 I37 A62 Y63 F128
Binding residue
(residue number reindexed from 1)		D23 L36 I37 A62 Y63 F122
Enzymatic activity
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
GO:0046872 metal ion binding
Biological Process
GO:0042026 protein refolding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3luo, PDBe:3luo, PDBj:3luo
PDBsum3luo
PubMed20230833
UniProtQ5SLE7

[Back to BioLiP]