Structure of PDB 3lrn Chain A Binding Site BS01

Receptor Information
>3lrn Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KENKKLLCRKCKALACYTADVRVIEESHYTVLGDAFKECFVSRPHPKPKQ
FSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQ
TLYSKWKDFHFEKIPFDPAEM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lrn The Structural Basis of 5' Triphosphate Double-Stranded RNA Recognition by RIG-I C-Terminal Domain.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
S829 H830 H847 F853 K858 K861 I875 K888 W908
Binding residue
(residue number reindexed from 1)
S27 H28 H45 F51 K56 K59 I73 K86 W106
Binding affinityPDBbind-CN: Kd=0.32nM
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
External links
PDB RCSB:3lrn, PDBe:3lrn, PDBj:3lrn
PDBsum3lrn
PubMed20637642
UniProtO95786|RIGI_HUMAN Antiviral innate immune response receptor RIG-I (Gene Name=RIGI)

[Back to BioLiP]