Structure of PDB 3lrh Chain A Binding Site BS01

Receptor Information
>3lrh Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYD
DDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVF
GGGTKVTVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lrh A Disulfide-Free Single-Domain V(L) Intrabody with Blocking Activity towards Huntingtin Reveals a Novel Mode of Epitope Recognition.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
T33 N35 I37 P45 L47 Y50 Y88 W99 F101
Binding residue
(residue number reindexed from 1)
T32 N34 I36 P44 L46 Y49 Y87 W98 F100
External links