Structure of PDB 3lny Chain A Binding Site BS01

Receptor Information
>3lny Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDG
RIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lny Crystallographic and nuclear magnetic resonance evaluation of the impact of peptide binding to the second PDZ domain of protein tyrosine phosphatase 1E.
Resolution1.3 Å
Binding residue
(original residue number in PDB)
S17 L18 I20 S21 V22 T23 H71 R79
Binding residue
(residue number reindexed from 1)
S17 L18 I20 S21 V22 T23 H71 R79
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:3lny, PDBe:3lny, PDBj:3lny
PDBsum3lny
PubMed20839809
UniProtQ12923|PTN13_HUMAN Tyrosine-protein phosphatase non-receptor type 13 (Gene Name=PTPN13)

[Back to BioLiP]