Structure of PDB 3lnq Chain A Binding Site BS01

Receptor Information

>3lnq Chain A (length=58) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNR
RAKWRKQE

Ligand information

>3lnq Chain B (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggtttaattaggg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3lnq Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
Resolution	2.25 Å
Binding residue (original residue number in PDB)	R87 R89 T90 F92 N135 K139
Binding residue (residue number reindexed from 1)	R1 R3 T4 F6 N49 K53
Binding affinity	PDBbind-CN: Kd=0.276uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3lnq, PDBe:3lnq, PDBj:3lnq
PDBsum	3lnq
PubMed	20389279
UniProt	Q06453\|AL_DROME Homeobox protein aristaless (Gene Name=al)

[Back to BioLiP]