Structure of PDB 3lly Chain A Binding Site BS01

Receptor Information
>3lly Chain A (length=133) Species: 3496 (Maclura pomifera) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVTFDDGAYTGIREINFEYNSETAIGGLRVTYDLNGMPFVAEDHKSFITG
FKPVKISLEFPSEYIVEVSGYVGKVEGYTVIRSLTFKTNKQTYGPYGVTN
GTPFSLPIENGLIVGFKGSIGYWLDYFSIYLSL
Ligand information
>3lly Chain B (length=16) Species: 3496 (Maclura pomifera) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GRNGKSQSIIVGPWGD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lly Characterization of the secondary binding sites of Maclura pomifera agglutinin by glycan array and crystallographic analyses.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		V72 T79 I81 F104 L106 D125 Y126 F127 S128 I129 Y130 L131
Binding residue
(residue number reindexed from 1)		V72 T79 I81 F104 L106 D125 Y126 F127 S128 I129 Y130 L131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0030246 carbohydrate binding

View graph for
Molecular Function
External links
PDB RCSB:3lly, PDBe:3lly, PDBj:3lly
PDBsum3lly
PubMed20826825
UniProtP18674|LECA_MACPO Agglutinin alpha chain

[Back to BioLiP]