Structure of PDB 3lh0 Chain A Binding Site BS01

Receptor Information
>3lh0 Chain A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDIL
LCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKR
MAVILSLEQGNRLREQYGLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lh0 Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
Y1502 D1521 Y1523
Binding residue
(residue number reindexed from 1)
Y19 D38 Y40
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3lh0, PDBe:3lh0, PDBj:3lh0
PDBsum3lh0
PubMed20307547
UniProtQ12888|TP53B_HUMAN TP53-binding protein 1 (Gene Name=TP53BP1)

[Back to BioLiP]