Structure of PDB 3lgf Chain A Binding Site BS01

Receptor Information
>3lgf Chain A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILL
CDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRM
AVILSLEQGNRLREQYGLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lgf Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
W1495 Y1502 F1519 D1521
Binding residue
(residue number reindexed from 1)
W11 Y18 F35 D37
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3lgf, PDBe:3lgf, PDBj:3lgf
PDBsum3lgf
PubMed20307547
UniProtQ12888|TP53B_HUMAN TP53-binding protein 1 (Gene Name=TP53BP1)

[Back to BioLiP]