Structure of PDB 3lcn Chain A Binding Site BS01

Receptor Information
>3lcn Chain A (length=96) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELAS
LFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLG
Ligand information
>3lcn Chain C (length=25) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TASKMKLLKKKIEEQREILQKTHHK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lcn Structural basis for the function of the Saccharomyces cerevisiae Gfd1 protein in mRNA nuclear export.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		D27 Y30 E33 Y34 L37 L38 N41 E51 L55
Binding residue
(residue number reindexed from 1)		D23 Y26 E29 Y30 L33 L34 N37 E47 L51
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3lcn, PDBe:3lcn, PDBj:3lcn
PDBsum3lcn
PubMed20463024
UniProtP32505|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 (Gene Name=NAB2)

[Back to BioLiP]