Structure of PDB 3l3c Chain A Binding Site BS01

Receptor Information
>3l3c Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>3l3c Chain P (length=141) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcaccauugcacuccggugccaguugacgaggugggguuuaucgagauu
ucggcggaugacucccgguuguucaucacaaccgcaagcuuuuacuuaaa
ucauuaaggugacuuaguggacaaaggugaaagugugauga
<<<<<<..........>>>>>>......(((...<<<<<<..))).....
.........>>>>>><<<<<<...((((>>>>>>...<<<<<<<<<....
<<<<<<<<....>>>>>>>.>....>>>>>>>>>.))))..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3l3c Structural and chemical basis for glucosamine 6-phosphate binding and activation of the glmS ribozyme
Resolution2.85 Å
Binding residue
(original residue number in PDB)		Y13 E19 K22 S48 L49 K50 M51 R52 Q54 F56 A87 K88 S91 D92
Binding residue
(residue number reindexed from 1)		Y7 E13 K16 S42 L43 K44 M45 R46 Q48 F50 A81 K82 S85 D86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3l3c, PDBe:3l3c, PDBj:3l3c
PDBsum3l3c
PubMed19228039
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]